Lineage for d144l__ (144l -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries) 
Domain d144l__: 144l - [36893]
Details for d144l__
PDB Entry: 144l (more details), 2.1 Å
PDB Description: role of backbone flexibility in the accommodation of variants that repack the core of t4 lysozyme
SCOP Domain Sequences for d144l__:
Sequence; same for both SEQRES and ATOM records: (download)
>d144l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
iqqkrwdelavnmaksrwynqtpnrakrvittwrtgtwdayk
SCOP Domain Coordinates for d144l__:
Click to download the PDB-style file with coordinates for d144l__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d144l__:
- d144l__ appears in SCOP 1.57
- d144l__ appears in the current release, SCOPe 2.08, called d144la_
View in 3D