SCOPe 2.08: Domain d6mymc2: 6mym C:333-502

Lineage for d6mymc2 (6mym C:333-502)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId:382825] [368908] (1 PDB entry)

8. Domain d6mymc2: 6mym C:333-502 [368909]
   Other proteins in same PDB: d6myma1, d6mymb1, d6mymc1
   automated match to d1ha0a2
   complexed with bma, nag

Details for d6mymc2

PDB Entry: 6mym, 2.45 Å

PDB Description: crystal structure of hemagglutinin from influenza virus a/phillipines/2/1982 (h3n2)

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6mymc2:

Sequence; same for both SEQRES and ATOM records:

>d6mymc2 h.3.1.0 (C:333-502) automated matches {Influenza a virus (a/philippines/2/1982(h3n2)) [TaxId: 382825]}
gaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
kqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

Timeline for d6mymc2:

• d6mymc2 first appeared in SCOPe 2.07