Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza a virus (a/netherlands/209/1980(h3n2)) [TaxId:1086943] [368876] (1 PDB entry) |
Domain d6n08a1: 6n08 A:8-326 [368895] Other proteins in same PDB: d6n08a2, d6n08b2, d6n08c2 automated match to d5k9kf1 complexed with nag |
PDB Entry: 6n08 (more details), 1.92 Å
SCOPe Domain Sequences for d6n08a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n08a1 b.19.1.2 (A:8-326) Hemagglutinin {Influenza a virus (a/netherlands/209/1980(h3n2)) [TaxId: 1086943]} nstatlclghhavpngtlvktitndqievtnatelvqssstgricdsphrildgknctlv dallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinesfnw tgvtqsggsyackrgsdnsffsrlnwlyeseskypvlnvtmpnngnfdklyiwgvhhpst dkeqtnlyvrasgrvtvstkrsqqtiipnigsrpwvrglssrisiywtivkpgdillins ngnliaprgyfkirtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpk yvkqntlklatgmrnvpek
Timeline for d6n08a1:
View in 3D Domains from other chains: (mouse over for more information) d6n08b1, d6n08b2, d6n08c1, d6n08c2 |