SCOPe 2.08: Domain d1tlaa_: 1tla A:

Lineage for d1tlaa_ (1tla A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d1tlaa_: 1tla A: [36887]
   complexed with cl, po4; mutant

Details for d1tlaa_

PDB Entry: 1tla, 2 Å

PDB Description: hydrophobic core repacking and aromatic-aromatic interaction in the thermostable mutant of t4 lysozyme ser 117 (right arrow) phe

PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d1tlaa_:

Sequence; same for both SEQRES and ATOM records:

>d1tlaa_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnflrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1tlaa_:

• d1tlaa_ first appeared (with stable ids) in SCOP 1.55, called d1tla__
  
• d1tlaa_ appears in SCOPe 2.07