Lineage for d6h3hb2 (6h3h B:110-215)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2361010Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2361021Domain d6h3hb2: 6h3h B:110-215 [368869]
    Other proteins in same PDB: d6h3hb1, d6h3hd1
    automated match to d1ngpl2
    complexed with gol, so4

Details for d6h3hb2

PDB Entry: 6h3h (more details), 1.92 Å

PDB Description: fab fragment of antibody against fullerene c60
PDB Compounds: (B:) Anti-fullerene antibody Fab fragment Light chain

SCOPe Domain Sequences for d6h3hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h3hb2 b.1.1.2 (B:110-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpsk
qsnnkymassyltltarawerhssyscqvtheghtvekslsradcs

SCOPe Domain Coordinates for d6h3hb2:

Click to download the PDB-style file with coordinates for d6h3hb2.
(The format of our PDB-style files is described here.)

Timeline for d6h3hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h3hb1