![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries) |
![]() | Domain d6h3hd1: 6h3h D:1-109 [368843] Other proteins in same PDB: d6h3hb2, d6h3hd2 automated match to d1ngpl1 complexed with gol, so4 |
PDB Entry: 6h3h (more details), 1.92 Å
SCOPe Domain Sequences for d6h3hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h3hd1 b.1.1.1 (D:1-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]} qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl
Timeline for d6h3hd1: