Lineage for d6h3hd1 (6h3h D:1-109)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354589Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2354681Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2354703Domain d6h3hd1: 6h3h D:1-109 [368843]
    Other proteins in same PDB: d6h3hb2, d6h3hd2
    automated match to d1ngpl1
    complexed with gol, so4

Details for d6h3hd1

PDB Entry: 6h3h (more details), 1.92 Å

PDB Description: fab fragment of antibody against fullerene c60
PDB Compounds: (D:) Anti-fullerene antibody Fab fragment Light chain

SCOPe Domain Sequences for d6h3hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h3hd1 b.1.1.1 (D:1-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOPe Domain Coordinates for d6h3hd1:

Click to download the PDB-style file with coordinates for d6h3hd1.
(The format of our PDB-style files is described here.)

Timeline for d6h3hd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h3hd2