Lineage for d6nz7b_ (6nz7 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040945Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries)
  8. 3041006Domain d6nz7b_: 6nz7 B: [368768]
    Other proteins in same PDB: d6nz7a_, d6nz7e_, d6nz7g_, d6nz7h_, d6nz7i1, d6nz7i2, d6nz7l1, d6nz7l2
    automated match to d5kanb_
    complexed with nag

Details for d6nz7b_

PDB Entry: 6nz7 (more details), 2.95 Å

PDB Description: crystal structure of broadly neutralizing influenza a antibody 429 b01 in complex with hemagglutinin hong kong 1968
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6nz7b_:

Sequence, based on SEQRES records: (download)

>d6nz7b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

Sequence, based on observed residues (ATOM records): (download)

>d6nz7b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevelekyvedtkidlwsynaellvalenqhtidltdsemnklfektrrqlre
naedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6nz7b_:

Click to download the PDB-style file with coordinates for d6nz7b_.
(The format of our PDB-style files is described here.)

Timeline for d6nz7b_: