SCOPe 2.08: Domain d6nz7l1: 6nz7 L:1-106

Lineage for d6nz7l1 (6nz7 L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6nz7l1: 6nz7 L:1-106 [368729]
   Other proteins in same PDB: d6nz7a_, d6nz7b_, d6nz7e_, d6nz7f_, d6nz7g_, d6nz7h_, d6nz7i2, d6nz7l2
   automated match to d1dn0a1
   complexed with nag

Details for d6nz7l1

PDB Entry: 6nz7, 2.95 Å

PDB Description: crystal structure of broadly neutralizing influenza a antibody 429 b01 in complex with hemagglutinin hong kong 1968

PDB Compounds: (L:) 429 B01 FAB light chain

SCOPe Domain Sequences for d6nz7l1:

Sequence; same for both SEQRES and ATOM records:

>d6nz7l1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgisynlawyqqkpgrvpnllihaasrlqsgapf
rfsgsgsgtdftltisslqpedvatyycqkydsvpltfgqgtkvei

Timeline for d6nz7l1:

• d6nz7l1 first appeared in SCOPe 2.07