Lineage for d6ok9a_ (6ok9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397498Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2397499Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2397500Protein Staphylococcal nuclease [50201] (1 species)
  7. 2397501Species Staphylococcus aureus [TaxId:1280] [50202] (270 PDB entries)
    Uniprot P00644 89-223
  8. 2397728Domain d6ok9a_: 6ok9 A: [368723]
    automated match to d2lkva_
    complexed with ca, thp

Details for d6ok9a_

PDB Entry: 6ok9 (more details), 1.9 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs k133m at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d6ok9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ok9a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
mkeklniws

SCOPe Domain Coordinates for d6ok9a_:

Click to download the PDB-style file with coordinates for d6ok9a_.
(The format of our PDB-style files is described here.)

Timeline for d6ok9a_:

  • d6ok9a_ is new in SCOPe 2.07-stable
  • d6ok9a_ does not appear in SCOPe 2.08