Lineage for d6nz7e_ (6nz7 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775893Domain d6nz7e_: 6nz7 E: [368703]
    Other proteins in same PDB: d6nz7b_, d6nz7f_, d6nz7g_, d6nz7h_, d6nz7i1, d6nz7i2, d6nz7l1, d6nz7l2
    automated match to d5k9qc_
    complexed with nag

Details for d6nz7e_

PDB Entry: 6nz7 (more details), 2.95 Å

PDB Description: crystal structure of broadly neutralizing influenza a antibody 429 b01 in complex with hemagglutinin hong kong 1968
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6nz7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nz7e_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst
nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins
ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqntlklatgmrnvpek

SCOPe Domain Coordinates for d6nz7e_:

Click to download the PDB-style file with coordinates for d6nz7e_.
(The format of our PDB-style files is described here.)

Timeline for d6nz7e_: