Lineage for d5lg7a_ (5lg7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037682Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 3037683Protein automated matches [190242] (4 species)
    not a true protein
  7. 3037688Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries)
  8. 3037712Domain d5lg7a_: 5lg7 A: [368593]
    automated match to d5d0ib_
    complexed with zn; mutant

Details for d5lg7a_

PDB Entry: 5lg7 (more details)

PDB Description: solution nmr structure of tryptophan to arginine mutant of arkadia ring domain
PDB Compounds: (A:) E3 ubiquitin-protein ligase Arkadia

SCOPe Domain Sequences for d5lg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lg7a_ g.44.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkqdgeegteedteekcticlsileegedvrrlpcmhlfhqvcvdqrlitnkkcpicrvd
ieaqlpses

SCOPe Domain Coordinates for d5lg7a_:

Click to download the PDB-style file with coordinates for d5lg7a_.
(The format of our PDB-style files is described here.)

Timeline for d5lg7a_: