Class g: Small proteins [56992] (100 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
Protein automated matches [190242] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries) |
Domain d5lg7a_: 5lg7 A: [368593] automated match to d5d0ib_ complexed with zn; mutant |
PDB Entry: 5lg7 (more details)
SCOPe Domain Sequences for d5lg7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lg7a_ g.44.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkqdgeegteedteekcticlsileegedvrrlpcmhlfhqvcvdqrlitnkkcpicrvd ieaqlpses
Timeline for d5lg7a_: