SCOPe 2.08: Domain d6hymb_: 6hym B:

Lineage for d6hymb_ (6hym B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d6hymb_: 6hym B: [368558]
   automated match to d5dpsb_
   complexed with edo, gol

Details for d6hymb_

PDB Entry: 6hym, 1.86 Å

PDB Description: structure of pcm1 lir motif bound to gabarap

PDB Compounds: (B:) Pericentriolar material 1 protein,Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d6hymb_:

Sequence; same for both SEQRES and ATOM records:

>d6hymb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deedfvkvedlplkgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdl
dkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedff
lyiaysdesvygl

Timeline for d6hymb_:

• d6hymb_ first appeared in SCOPe 2.07