Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Halomonas elongata [TaxId:768066] [368542] (1 PDB entry) |
Domain d6gwib_: 6gwi B: [368543] automated match to d5ghfa_ complexed with cl, edo, plp |
PDB Entry: 6gwi (more details), 2 Å
SCOPe Domain Sequences for d6gwib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gwib_ c.67.1.0 (B:) automated matches {Halomonas elongata [TaxId: 768066]} mqtqdyqaldrahhlhpftdfkalgeegsrvvthaegvyihdsegnrildgmaglwcvnl gygrrelveaataqleqlpyyntffktthppavrlaeklcdlapahinrvfftgsgsean dtvlrmvrrywalkgqpdkqwiigrenayhgstlagmslggmapmhaqggpcvpgiahir qpywfgegrdmspeafgqtcaealeekilelgeekvaafiaepvqgaggaimppesywpa vkkvlakydillvadevicgfgrlgewfgsqhyglepdlmpiakglssgylpiggvlvgd rvaetlieeggeffhgftysghptcaavalknlelleaegvvdrvrddlgpylaerwasl vdhpivgearslglmgalelvadkttgqrfdkslgagnlcrdlcfanglvmrsvgdtmii spplvirreeidelvelarraldetarqlt
Timeline for d6gwib_: