Lineage for d6digb2 (6dig B:95-190)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (888 PDB entries)
  8. 3068452Domain d6digb2: 6dig B:95-190 [368514]
    Other proteins in same PDB: d6diga1, d6digb1
    automated match to d1jk8b1
    complexed with nag, trs

Details for d6digb2

PDB Entry: 6dig (more details), 2 Å

PDB Description: crystal structure of dq6 in complex with a neuro-peptide
PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d6digb2:

Sequence, based on SEQRES records: (download)

>d6digb2 b.1.1.2 (B:95-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veptvtispsrtealnhhnllvcsvtdfypgqikvrwfrndqeetagvvstplirngdwt
fqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records): (download)

>d6digb2 b.1.1.2 (B:95-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veptvtispsnllvcsvtdfypgqikvrwfrndqeetagvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqspitvewra

SCOPe Domain Coordinates for d6digb2:

Click to download the PDB-style file with coordinates for d6digb2.
(The format of our PDB-style files is described here.)

Timeline for d6digb2:

  • d6digb2 appears in periodic updates to SCOPe 2.07 starting on 2019-05-09

View in 3D
Domains from same chain:
(mouse over for more information)
d6digb1