Lineage for d6digb1 (6dig B:3-94)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 3068450Domain d6digb1: 6dig B:3-94 [368512]
    Other proteins in same PDB: d6diga2, d6digb2
    automated match to d1jk8b2
    complexed with nag, trs

Details for d6digb1

PDB Entry: 6dig (more details), 2 Å

PDB Description: crystal structure of dq6 in complex with a neuro-peptide
PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d6digb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6digb1 d.19.1.0 (B:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrpdaeywn
sqkevlegtraeldtvcrhnyevafrgilqrr

SCOPe Domain Coordinates for d6digb1:

Click to download the PDB-style file with coordinates for d6digb1.
(The format of our PDB-style files is described here.)

Timeline for d6digb1:

  • d6digb1 appears in periodic updates to SCOPe 2.07 starting on 2019-05-09

View in 3D
Domains from same chain:
(mouse over for more information)
d6digb2