SCOPe 2.08: Domain d6dl7d1: 6dl7 D:58-249

Lineage for d6dl7d1 (6dl7 D:58-249)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
   automatically mapped to Pfam PF00574

6. Protein Clp protease, ClpP subunit [52098] (11 species)

7. Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (4 PDB entries)
   Uniprot Q16740 57-249

8. Domain d6dl7d1: 6dl7 D:58-249 [368502]
   Other proteins in same PDB: d6dl7a2, d6dl7b2, d6dl7c2, d6dl7d2, d6dl7e2, d6dl7f2, d6dl7g2
   automated match to d1tg6e_
   complexed with onc

Details for d6dl7d1

PDB Entry: 6dl7, 2 Å

PDB Description: human mitochondrial clpp in complex with onc201 (tic10)

PDB Compounds: (D:) ATP-dependent Clp protease proteolytic subunit, mitochondrial

SCOPe Domain Sequences for d6dl7d1:

Sequence, based on SEQRES records:

>d6dl7d1 c.14.1.1 (D:58-249) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
lipivveqtgrgeraydiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihm
yinspggvvtaglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimi
hqpsggargqatdiaiqaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqe
fgildkvlvhpp

Sequence, based on observed residues (ATOM records):

>d6dl7d1 c.14.1.1 (D:58-249) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
lipivvdiysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmyinspggvvt
aglaiydtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsatdiai
qaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhpp

Timeline for d6dl7d1:

• d6dl7d1 first appeared in SCOPe 2.07