Lineage for d195l__ (195l -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 29167Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein)
  6. 29168Protein Phage T4 lysozyme [53982] (1 species)
  7. 29169Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries)
  8. 29369Domain d195l__: 195l - [36841]

Details for d195l__

PDB Entry: 195l (more details), 1.9 Å

PDB Description: thermodynamic and structural compensation in "size-switch" core- repacking variants of t4 lysozyme

SCOP Domain Sequences for d195l__:

Sequence; same for both SEQRES and ATOM records: (download)

>d195l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdelavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOP Domain Coordinates for d195l__:

Click to download the PDB-style file with coordinates for d195l__.
(The format of our PDB-style files is described here.)

Timeline for d195l__: