Lineage for d6e9il1 (6e9i L:3-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355291Species Cow (Bos taurus) [TaxId:9913] [226022] (15 PDB entries)
  8. 3068296Domain d6e9il1: 6e9i L:3-112 [368358]
    automated match to d4k3el1

Details for d6e9il1

PDB Entry: 6e9i (more details), 2.5 Å

PDB Description: the crystal structure of bovine ultralong antibody bov-4
PDB Compounds: (L:) Bovine ultralong antibody BOV-4 light chain

SCOPe Domain Sequences for d6e9il1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e9il1 b.1.1.0 (L:3-112) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlg

SCOPe Domain Coordinates for d6e9il1:

Click to download the PDB-style file with coordinates for d6e9il1.
(The format of our PDB-style files is described here.)

Timeline for d6e9il1: