Lineage for d1l89__ (1l89 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries) 
Domain d1l89__: 1l89 - [36832]
Details for d1l89__
PDB Entry: 1l89 (more details), 1.9 Å
PDB Description: similar hydrophobic replacements of leu 99 and phe 153 within the core of t4 lysozyme have different structural and thermodynamic consequences
SCOP Domain Sequences for d1l89__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l89__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittartgtwdayk
SCOP Domain Coordinates for d1l89__:
Click to download the PDB-style file with coordinates for d1l89__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l89__:
- d1l89__ appears in SCOP 1.57
- d1l89__ appears in the current release, SCOPe 2.08, called d1l89a_
View in 3D