Lineage for d6nfqa_ (6nfq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766514Species Pseudomonas fluorescens [TaxId:294] [368198] (4 PDB entries)
  8. 2766517Domain d6nfqa_: 6nfq A: [368199]
    automated match to d1nm4a_
    complexed with cu, yt3

Details for d6nfqa_

PDB Entry: 6nfq (more details), 2 Å

PDB Description: copc from pseudomonas fluorescens
PDB Compounds: (A:) CopC

SCOPe Domain Sequences for d6nfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nfqa_ b.1.18.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
hahlksatpaadstvaapadlrltfsegveatftkvslskdgtevaikgletpdadkktl
vvtpaaplaagnykvvwnavsvdthksngeysfkvk

SCOPe Domain Coordinates for d6nfqa_:

Click to download the PDB-style file with coordinates for d6nfqa_.
(The format of our PDB-style files is described here.)

Timeline for d6nfqa_: