Lineage for d6j4kb_ (6j4k B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306158Species Arabidopsis thaliana [TaxId:3702] [368129] (1 PDB entry)
  8. 2306160Domain d6j4kb_: 6j4k B: [368164]
    automated match to d1irza_
    complexed with gol, mla

Details for d6j4kb_

PDB Entry: 6j4k (more details), 1.58 Å

PDB Description: structural basis for the target dna recognition and binding by the myb domain of phosphate starvation response 1
PDB Compounds: (B:) Protein PHOSPHATE STARVATION RESPONSE 1

SCOPe Domain Sequences for d6j4kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j4kb_ a.4.1.0 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
gkarmrwtpelheafveavnslggseratpkgvlkimkvegltiyhvkshlqkyrtar

SCOPe Domain Coordinates for d6j4kb_:

Click to download the PDB-style file with coordinates for d6j4kb_.
(The format of our PDB-style files is described here.)

Timeline for d6j4kb_: