![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Arabidopsis thaliana [TaxId:3702] [368129] (1 PDB entry) |
![]() | Domain d6j4kb_: 6j4k B: [368164] automated match to d1irza_ complexed with gol, mla |
PDB Entry: 6j4k (more details), 1.58 Å
SCOPe Domain Sequences for d6j4kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j4kb_ a.4.1.0 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]} gkarmrwtpelheafveavnslggseratpkgvlkimkvegltiyhvkshlqkyrtar
Timeline for d6j4kb_: