Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [334147] (3 PDB entries) |
Domain d6m7gg_: 6m7g G: [368162] automated match to d5jtfa_ complexed with ppq |
PDB Entry: 6m7g (more details), 2.66 Å
SCOPe Domain Sequences for d6m7gg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m7gg_ d.108.1.0 (G:) automated matches {Pseudomonas putida [TaxId: 160488]} gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfl
Timeline for d6m7gg_: