Lineage for d6j4ka_ (6j4k A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692882Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [368129] (1 PDB entry)
  8. 2692883Domain d6j4ka_: 6j4k A: [368130]
    automated match to d1irza_
    complexed with gol, mla

Details for d6j4ka_

PDB Entry: 6j4k (more details), 1.58 Å

PDB Description: structural basis for the target dna recognition and binding by the myb domain of phosphate starvation response 1
PDB Compounds: (A:) Protein PHOSPHATE STARVATION RESPONSE 1

SCOPe Domain Sequences for d6j4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j4ka_ a.4.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gkarmrwtpelheafveavnslggseratpkgvlkimkvegltiyhvkshlqkyrtaryr

SCOPe Domain Coordinates for d6j4ka_:

Click to download the PDB-style file with coordinates for d6j4ka_.
(The format of our PDB-style files is described here.)

Timeline for d6j4ka_: