Lineage for d235la_ (235l A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014129Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 1014135Protein Phage T4 lysozyme [53982] (1 species)
  7. 1014136Species Bacteriophage T4 [TaxId:10665] [53983] (520 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1014443Domain d235la_: 235l A: [36812]
    complexed with cl, hed

Details for d235la_

PDB Entry: 235l (more details), 1.9 Å

PDB Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d235la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d235la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgaagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d235la_:

Click to download the PDB-style file with coordinates for d235la_.
(The format of our PDB-style files is described here.)

Timeline for d235la_: