Lineage for d6ghoa1 (6gho A:1-125)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457279Family c.47.1.12: ArsC-like [69518] (4 proteins)
    Pfam PF03960
  6. 2457292Protein automated matches [190780] (4 species)
    not a true protein
  7. 3068011Species Bacillus subtilis [TaxId:224308] [368073] (2 PDB entries)
  8. 3068015Domain d6ghoa1: 6gho A:1-125 [368077]
    Other proteins in same PDB: d6ghoa2
    automated match to d3gfka_
    complexed with cl

Details for d6ghoa1

PDB Entry: 6gho (more details), 1.79 Å

PDB Description: crystal structure of spx in complex with yjbh
PDB Compounds: (A:) Regulatory protein spx

SCOPe Domain Sequences for d6ghoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghoa1 c.47.1.12 (A:1-125) automated matches {Bacillus subtilis [TaxId: 224308]}
mvtlytspsctscrkarawleeheipfvernifseplsideikqilrmtedgtdeiistr
skvfqklnvnvesmplqdlyrlinehpgllrrpiiidekrlqvgynedeirrflprkvrs
fqlre

SCOPe Domain Coordinates for d6ghoa1:

Click to download the PDB-style file with coordinates for d6ghoa1.
(The format of our PDB-style files is described here.)

Timeline for d6ghoa1:

  • d6ghoa1 is new in SCOPe 2.07-stable