SCOP 1.75: Domain d1c6ia_: 1c6i A:

Lineage for d1c6ia_ (1c6i A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.3: Phage lysozyme [53981] (3 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (446 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d1c6ia_: 1c6i A: [36799]
   complexed with ar, bme, cl; mutant

Details for d1c6ia_

PDB Entry: 1c6i, 1.9 Å

PDB Description: t4 lysozyme mutant c54t/c97a/l99a in the presence of 8 atm argon

PDB Compounds: (A:) protein (lysozyme)

SCOP Domain Sequences for d1c6ia_:

Sequence; same for both SEQRES and ATOM records:

>d1c6ia_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1c6ia_:

• d1c6ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1c6ia_ appears in SCOP 1.73
  
• d1c6ia_ appears in SCOPe 2.01
  
• d1c6ia_ appears in the current release, SCOPe 2.08