Lineage for d5ziua_ (5ziu A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017732Protein automated matches [190260] (25 species)
    not a true protein
  7. 3017752Species Enterovirus d68 [TaxId:42789] [336371] (3 PDB entries)
  8. 3017754Domain d5ziua_: 5ziu A: [367958]
    automated match to d5xe0a_
    protein/RNA complex; complexed with gol, peg

Details for d5ziua_

PDB Entry: 5ziu (more details), 2.15 Å

PDB Description: crystal structure of human entervirus d68 rdrp
PDB Compounds: (A:) RdRp

SCOPe Domain Sequences for d5ziua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ziua_ e.8.1.4 (A:) automated matches {Enterovirus d68 [TaxId: 42789]}
geivsneksgvcinapaktklqpsvfhqvfegskepavlnskdprlktdfeeaifskytg
nkimlmdeymeeavdhyvgclepldisidpiplesamygmdglealdlttsagfpyllqg
kkkrdifnrqtrdttemtrmlekygvdlpfvtfvkdelrsrekvekgksrlieasslnds
vamrvafgnlyatfhnnpgtatgsavgcdpdvfwskipillngeifafdytgydaslspv
wfaclkkvliklgythqtsfidylchsvhlykdrkyivnggmpsgssgtsifntminnii
irtllirvykgidldqfkmiaygddviasyphkidpgllaeagkhyglimtpadkgtsfv
dtnwenvtflkryfraddqypflihpvmpmkeihesirwtkdprntqdhvrslcylawhn
geeaynefcrkirsvpvgraltlpaysslrrkwldsf

SCOPe Domain Coordinates for d5ziua_:

Click to download the PDB-style file with coordinates for d5ziua_.
(The format of our PDB-style files is described here.)

Timeline for d5ziua_: