Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries) |
Domain d6q60a1: 6q60 A:3-264 [367892] Other proteins in same PDB: d6q60a2, d6q60b2 automated match to d4h8ja_ complexed with cl, gol, hjh, li, so4 |
PDB Entry: 6q60 (more details), 1.55 Å
SCOPe Domain Sequences for d6q60a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q60a1 c.94.1.1 (A:3-264) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]} nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln eqglldklknkwwydkgecgsg
Timeline for d6q60a1: