Lineage for d1cu2a_ (1cu2 A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.3: Phage T4 lysozyme [53981] (1 protein) Protein Phage T4 lysozyme [53982] (1 species) Species Bacteriophage T4 [TaxId:10665] [53983] (336 PDB entries) 
Domain d1cu2a_: 1cu2 A: [36788]
Details for d1cu2a_
PDB Entry: 1cu2 (more details), 1.85 Å
PDB Description: t4 lysozyme mutant l84m
SCOP Domain Sequences for d1cu2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cu2a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnakmkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
SCOP Domain Coordinates for d1cu2a_:
Click to download the PDB-style file with coordinates for d1cu2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cu2a_:
- d1cu2a_ appears in SCOP 1.57
- d1cu2a_ appears in the current release, SCOPe 2.08
View in 3D