Lineage for d6miab_ (6mia B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013652Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)
  8. 3013751Domain d6miab_: 6mia B: [367835]
    automated match to d4ua6a_
    complexed with 1ce

Details for d6miab_

PDB Entry: 6mia (more details), 1.4 Å

PDB Description: crystal structure of ctx-m-14 with compound 6
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6miab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6miab_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

SCOPe Domain Coordinates for d6miab_:

Click to download the PDB-style file with coordinates for d6miab_.
(The format of our PDB-style files is described here.)

Timeline for d6miab_: