SCOPe 2.08: Domain d6cxsa2: 6cxs A:183-275

Lineage for d6cxsa2 (6cxs A:183-275)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.0: automated matches [254272] (1 protein)
   not a true family

6. Protein automated matches [254633] (19 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:195102] [267955] (2 PDB entries)

8. Domain d6cxsa2: 6cxs A:183-275 [367776]
   Other proteins in same PDB: d6cxsa1, d6cxsa3, d6cxsa4, d6cxsb1, d6cxsb3, d6cxsb4, d6cxsd1, d6cxsd2
   automated match to d4jkla2
   complexed with fjv

Details for d6cxsa2

PDB Entry: 6cxs, 2.8 Å

PDB Description: crystal structure of clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4- tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl) morpholine

PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6cxsa2:

Sequence; same for both SEQRES and ATOM records:

>d6cxsa2 b.1.4.0 (A:183-275) automated matches {Clostridium perfringens [TaxId: 195102]}
syieditivtdfkenngyvnyevqavgkcnikvtiideennivaegegkegkltinnvhl
wepmnaylyklkvellddeeiidtyfeefgvrt

Timeline for d6cxsa2:

• d6cxsa2 first appeared in SCOPe 2.07