Lineage for d6d49b1 (6d49 B:18-142)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (223 PDB entries)
  8. 3067694Domain d6d49b1: 6d49 B:18-142 [367756]
    Other proteins in same PDB: d6d49a2, d6d49b2
    automated match to d1nkoa_
    complexed with fvp, gol

Details for d6d49b1

PDB Entry: 6d49 (more details), 1.8 Å

PDB Description: cell surface receptor in complex with ligand at 1.80-a resolution
PDB Compounds: (B:) Myeloid cell surface antigen CD33

SCOPe Domain Sequences for d6d49b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d49b1 b.1.1.1 (B:18-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
vtdlt

SCOPe Domain Coordinates for d6d49b1:

Click to download the PDB-style file with coordinates for d6d49b1.
(The format of our PDB-style files is described here.)

Timeline for d6d49b1:

  • d6d49b1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18

View in 3D
Domains from same chain:
(mouse over for more information)
d6d49b2