SCOPe 2.08: Domain d6dfvc1: 6dfv C:3-117

Lineage for d6dfvc1 (6dfv C:3-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6dfvc1: 6dfv C:3-117 [367752]
   Other proteins in same PDB: d6dfva2, d6dfvb2, d6dfvc2, d6dfvd2
   automated match to d2f54d1
   complexed with edo

Details for d6dfvc1

PDB Entry: 6dfv, 1.71 Å

PDB Description: mouse diabetogenic tcr 8f10

PDB Compounds: (C:) TcR alpha chain

SCOPe Domain Sequences for d6dfvc1:

Sequence, based on SEQRES records:

>d6dfvc1 b.1.1.0 (C:3-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqlpsilrvqegssasincsyedsasnyfpwykqepgenpkliidirsnmerkqtqgl
ivlldkkakrfslhitdtqpgdsamyfcaasrrgsggsnykltfgkgtlltvtpn

Sequence, based on observed residues (ATOM records):

>d6dfvc1 b.1.1.0 (C:3-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqlpsilrvqegssasincsyedsasnyfpwykqepgenpkliidirsnmerkqtqgl
ivlldkkakrfslhitdtqpgdsamyfcaasrrgsnykltfgkgtlltvtpn

Timeline for d6dfvc1:

• d6dfvc1 first appeared in SCOPe 2.07