Lineage for d6d1ga_ (6d1g A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997710Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 2997755Domain d6d1ga_: 6d1g A: [367742]
    automated match to d4u4la_
    complexed with act, ykg, zn

Details for d6d1ga_

PDB Entry: 6d1g (more details), 1.15 Å

PDB Description: crystal structure of ndm-1 complexed with compound 9
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6d1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d1ga_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d6d1ga_:

Click to download the PDB-style file with coordinates for d6d1ga_.
(The format of our PDB-style files is described here.)

Timeline for d6d1ga_: