SCOPe 2.08: Domain d6dfvd1: 6dfv D:2-113

Lineage for d6dfvd1 (6dfv D:2-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6dfvd1: 6dfv D:2-113 [367740]
   Other proteins in same PDB: d6dfva2, d6dfvb2, d6dfvc2, d6dfvd2
   automated match to d3of6c1
   complexed with edo

Details for d6dfvd1

PDB Entry: 6dfv, 1.71 Å

PDB Description: mouse diabetogenic tcr 8f10

PDB Compounds: (D:) TCR beta chain

SCOPe Domain Sequences for d6dfvd1:

Sequence; same for both SEQRES and ATOM records:

>d6dfvd1 b.1.1.0 (D:2-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscdqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqkefslilelatpsqtsvyfcasgglggdeqyfgpgtrltvled

Timeline for d6dfvd1:

• d6dfvd1 first appeared in SCOPe 2.07