Lineage for d6d4ab_ (6d4a B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (228 PDB entries)
  8. 3067673Domain d6d4ab_: 6d4a B: [367735]
    automated match to d1nkoa_
    complexed with fvp, gol

Details for d6d4ab_

PDB Entry: 6d4a (more details), 1.75 Å

PDB Description: cell surface receptor with bound ligand at 1.75-a resolution
PDB Compounds: (B:) Myeloid cell surface antigen CD33

SCOPe Domain Sequences for d6d4ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d4ab_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
vtdl

SCOPe Domain Coordinates for d6d4ab_:

Click to download the PDB-style file with coordinates for d6d4ab_.
(The format of our PDB-style files is described here.)

Timeline for d6d4ab_: