Lineage for d6d0vb1 (6d0v B:2-394)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (15 species)
    not a true protein
  7. 3067670Species Salmonella enterica [TaxId:99287] [367732] (1 PDB entry)
  8. 3067671Domain d6d0vb1: 6d0v B:2-394 [367733]
    Other proteins in same PDB: d6d0va_, d6d0vb2
    automated match to d2j9zb_
    complexed with cl, cs, dms, edo, f9f, p1t, peg, ser; mutant

Details for d6d0vb1

PDB Entry: 6d0v (more details), 1.64 Å

PDB Description: tryptophan synthase q114a mutant in complex with inhibitor n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) at the alpha-site, aminoacrylate (p1t) at the beta site, and cesium ion at the metal coordination site
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d6d0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d0vb1 c.79.1.1 (B:2-394) automated matches {Salmonella enterica [TaxId: 99287]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagahgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkar

SCOPe Domain Coordinates for d6d0vb1:

Click to download the PDB-style file with coordinates for d6d0vb1.
(The format of our PDB-style files is described here.)

Timeline for d6d0vb1:

  • d6d0vb1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18

View in 3D
Domains from same chain:
(mouse over for more information)
d6d0vb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6d0va_