SCOPe 2.08: Domain d6dfqb1: 6dfq B:1-113

Lineage for d6dfqb1 (6dfq B:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6dfqb1: 6dfq B:1-113 [367730]
   Other proteins in same PDB: d6dfqa2, d6dfqc2, d6dfqe2, d6dfqg2
   automated match to d3o4le1
   complexed with ca, edo

Details for d6dfqb1

PDB Entry: 6dfq, 2.6 Å

PDB Description: mouse diabetogenic tcr i.29

PDB Compounds: (B:) TCR beta chain

SCOPe Domain Sequences for d6dfqb1:

Sequence, based on SEQRES records:

>d6dfqb1 b.1.1.0 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvle

Sequence, based on observed residues (ATOM records):

>d6dfqb1 b.1.1.0 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsagyeqyfgpgtrltvle

Timeline for d6dfqb1:

• d6dfqb1 first appeared in SCOPe 2.07