Lineage for d6d48f_ (6d48 F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (228 PDB entries)
  8. 3067658Domain d6d48f_: 6d48 F: [367720]
    automated match to d1nkoa_

Details for d6d48f_

PDB Entry: 6d48 (more details), 1.78 Å

PDB Description: cell surface receptor
PDB Compounds: (F:) Myeloid cell surface antigen CD33

SCOPe Domain Sequences for d6d48f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d48f_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnfwlqvqesvtvqeglcvlvpctffhpipyydknspvhgywfregaiisrdspvatnk
ldqevqeetqgrfrllgdpsrnncslsivdarrrdngsyffrmergstkysykspqlsvh
vtdlt

SCOPe Domain Coordinates for d6d48f_:

Click to download the PDB-style file with coordinates for d6d48f_.
(The format of our PDB-style files is described here.)

Timeline for d6d48f_: