SCOPe 2.08: Domain d5zn9b_: 5zn9 B:

Lineage for d5zn9b_ (5zn9 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.189: PX domain [64267] (1 superfamily)
   beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch

4. Superfamily d.189.1: PX domain [64268] (2 families)

5. Family d.189.1.0: automated matches [191384] (1 protein)
   not a true family

6. Protein automated matches [190483] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187420] (17 PDB entries)

8. Domain d5zn9b_: 5zn9 B: [367671]
   automated match to d4hasa_
   complexed with so4

Details for d5zn9b_

PDB Entry: 5zn9, 1.78 Å

PDB Description: crystal structure of px domain

PDB Compounds: (B:) Sorting nexin-27

SCOPe Domain Sequences for d5zn9b_:

Sequence; same for both SEQRES and ATOM records:

>d5zn9b_ d.189.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpisvprykhveqngekfvvynvymagrqlcskryrefailhqnlkrefanftfprlpgk
wpfslseqqldarrrgleeylekvcsirvigesdimqeflse

Timeline for d5zn9b_:

• d5zn9b_ first appeared in SCOPe 2.07