Lineage for d5znxa_ (5znx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 2307667Species Vibrio vulnificus [TaxId:216895] [267843] (2 PDB entries)
  8. 3067595Domain d5znxa_: 5znx A: [367657]
    automated match to d4ooib_

Details for d5znxa_

PDB Entry: 5znx (more details), 2.11 Å

PDB Description: crystal structure of cm14-treated hlyu from vibrio vulnificus
PDB Compounds: (A:) Transcriptional activator

SCOPe Domain Sequences for d5znxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5znxa_ a.4.5.0 (A:) automated matches {Vibrio vulnificus [TaxId: 216895]}
kdmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawlrrd
glvttrkeaqtvyytlkseevkamikllhslycee

SCOPe Domain Coordinates for d5znxa_:

Click to download the PDB-style file with coordinates for d5znxa_.
(The format of our PDB-style files is described here.)

Timeline for d5znxa_:

  • d5znxa_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-11