SCOPe 2.08: Domain d146la_: 146l A:

Lineage for d146la_ (146l A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d146la_: 146l A: [36763]
   complexed with bme, cl

Details for d146la_

PDB Entry: 146l, 1.85 Å

PDB Description: role of backbone flexibility in the accommodation of variants that repack the core of t4 lysozyme

PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d146la_:

Sequence; same for both SEQRES and ATOM records:

>d146la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
mqqkrwdelavnmaksrwynqtpnrakriittwrtgtwdayk

Timeline for d146la_:

• d146la_ first appeared (with stable ids) in SCOP 1.55, called d146l__
  
• d146la_ appears in SCOPe 2.07