Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
Protein automated matches [227057] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [360608] (3 PDB entries) |
Domain d6g40c1: 6g40 C:9-135 [367612] Other proteins in same PDB: d6g40a2, d6g40b2, d6g40c2, d6g40c3 automated match to d2xhia1 protein/DNA complex; complexed with act, elk, ni, peg |
PDB Entry: 6g40 (more details), 2.49 Å
SCOPe Domain Sequences for d6g40c1:
Sequence, based on SEQRES records: (download)
>d6g40c1 d.129.1.0 (C:9-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]} shmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltq tedqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfq gvrllrq
>d6g40c1 d.129.1.0 (C:9-135) automated matches {Mouse (Mus musculus) [TaxId: 10090]} shmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltq tedqlyctvyrgddvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqgv rllrq
Timeline for d6g40c1:
View in 3D Domains from other chains: (mouse over for more information) d6g40a1, d6g40a2, d6g40b1, d6g40b2 |