Lineage for d6q4ra3 (6q4r A:530-614)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2363428Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2363450Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2363451Protein automated matches [254707] (4 species)
    not a true protein
  7. 2363452Species Human (Homo sapiens) [TaxId:9606] [255965] (17 PDB entries)
  8. 3067530Domain d6q4ra3: 6q4r A:530-614 [367592]
    Other proteins in same PDB: d6q4ra1, d6q4ra2, d6q4ra4
    automated match to d2xdta3
    complexed with b3p, bma, edo, hj5, mlt, na, nag, p6g, pg4, zn

Details for d6q4ra3

PDB Entry: 6q4r (more details), 1.6 Å

PDB Description: high-resolution crystal structure of erap1 with bound phosphinic transition-state analogue inhibitor
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 1,Endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6q4ra3:

Sequence, based on SEQRES records: (download)

>d6q4ra3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records): (download)

>d6q4ra3 b.1.30.0 (A:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgdtgylwhvpltfitsksdmvhrfllktktdvlilpee
vewikfnvgmngyyivhyed

SCOPe Domain Coordinates for d6q4ra3:

Click to download the PDB-style file with coordinates for d6q4ra3.
(The format of our PDB-style files is described here.)

Timeline for d6q4ra3:

  • d6q4ra3 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11