Lineage for d6q4ra2 (6q4r A:255-529)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 3067529Domain d6q4ra2: 6q4r A:255-529 [367591]
    Other proteins in same PDB: d6q4ra1, d6q4ra3, d6q4ra4
    automated match to d2xdta2
    complexed with b3p, bma, edo, hj5, mlt, na, nag, p6g, pg4, zn

Details for d6q4ra2

PDB Entry: 6q4r (more details), 1.6 Å

PDB Description: high-resolution crystal structure of erap1 with bound phosphinic transition-state analogue inhibitor
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 1,Endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6q4ra2:

Sequence, based on SEQRES records: (download)

>d6q4ra2 d.92.1.0 (A:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasigsggvdvkt
mmntwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d6q4ra2 d.92.1.0 (A:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasivdvktmmnt
wtlqkg

SCOPe Domain Coordinates for d6q4ra2:

Click to download the PDB-style file with coordinates for d6q4ra2.
(The format of our PDB-style files is described here.)

Timeline for d6q4ra2:

  • d6q4ra2 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11