Lineage for d6q4ra1 (6q4r A:45-254)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409030Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2409031Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2409115Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2409116Protein automated matches [254706] (5 species)
    not a true protein
  7. 2409120Species Human (Homo sapiens) [TaxId:9606] [255964] (19 PDB entries)
  8. 3067528Domain d6q4ra1: 6q4r A:45-254 [367590]
    Other proteins in same PDB: d6q4ra2, d6q4ra3, d6q4ra4
    automated match to d2xdta1
    complexed with b3p, bma, edo, hj5, mlt, na, nag, p6g, pg4, zn

Details for d6q4ra1

PDB Entry: 6q4r (more details), 1.6 Å

PDB Description: high-resolution crystal structure of erap1 with bound phosphinic transition-state analogue inhibitor
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 1,Endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d6q4ra1:

Sequence, based on SEQRES records: (download)

>d6q4ra1 b.98.1.0 (A:45-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisr
atlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyk
styrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvks
vtvaegliedhfdvtvkmstylvafiisdf

Sequence, based on observed residues (ATOM records): (download)

>d6q4ra1 b.98.1.0 (A:45-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisr
atlrkrlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyr
tkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtva
egliedhfdvtvkmstylvafiisdf

SCOPe Domain Coordinates for d6q4ra1:

Click to download the PDB-style file with coordinates for d6q4ra1.
(The format of our PDB-style files is described here.)

Timeline for d6q4ra1:

  • d6q4ra1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11