Lineage for d6mg5a2 (6mg5 A:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750306Domain d6mg5a2: 6mg5 A:108-214 [367585]
    Other proteins in same PDB: d6mg5a1, d6mg5b1
    automated match to d1lila2
    complexed with 6zw, po4

Details for d6mg5a2

PDB Entry: 6mg5 (more details), 1.8 Å

PDB Description: structure of full-length human lambda-6a light chain jto in complex with coumarin 1
PDB Compounds: (A:) Light chain JTO

SCOPe Domain Sequences for d6mg5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mg5a2 b.1.1.2 (A:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvaptec

SCOPe Domain Coordinates for d6mg5a2:

Click to download the PDB-style file with coordinates for d6mg5a2.
(The format of our PDB-style files is described here.)

Timeline for d6mg5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mg5a1