Lineage for d6qapa1 (6qap A:1-494)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482355Species Human (Homo sapiens) [TaxId:9606] [225691] (20 PDB entries)
  8. 3067517Domain d6qapa1: 6qap A:1-494 [367579]
    Other proteins in same PDB: d6qapa2, d6qapb2, d6qapc2, d6qapd2
    automated match to d2opxa_
    complexed with edo, na, peg

Details for d6qapa1

PDB Entry: 6qap (more details), 2.3 Å

PDB Description: structure of the human aldehyde dehydrogenase 9a1 in c2 space group
PDB Compounds: (A:) 4-trimethylaminobutyraldehyde dehydrogenase

SCOPe Domain Sequences for d6qapa1:

Sequence, based on SEQRES records: (download)

>d6qapa1 c.82.1.0 (A:1-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnaka
afkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcleyy
aglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvfk
pspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftgsvptgmki
memsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgqvccngtrvfvqkei
ldkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkvakeqgakvlcggdiy
vpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdteaevlerandttfgla
agvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfgrengrvtieyysql
ktvcvemgdvesaf

Sequence, based on observed residues (ATOM records): (download)

>d6qapa1 c.82.1.0 (A:1-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnaka
afkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcleyy
aglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvfk
pspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftgkspliifs
dcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplledt
rmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrddm
tcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcfi
nnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf

SCOPe Domain Coordinates for d6qapa1:

Click to download the PDB-style file with coordinates for d6qapa1.
(The format of our PDB-style files is described here.)

Timeline for d6qapa1:

  • d6qapa1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11