Lineage for d6qaof1 (6qao F:1-494)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482355Species Human (Homo sapiens) [TaxId:9606] [225691] (20 PDB entries)
  8. 3067515Domain d6qaof1: 6qao F:1-494 [367577]
    Other proteins in same PDB: d6qaoa2, d6qaob2, d6qaoc2, d6qaod2, d6qaoe2, d6qaof2, d6qaog2, d6qaoh2
    automated match to d2opxa_
    complexed with peg

Details for d6qaof1

PDB Entry: 6qao (more details), 2.89 Å

PDB Description: structure of human aldehyde dehydrogenase 9a1 in p21 space group
PDB Compounds: (F:) 4-trimethylaminobutyraldehyde dehydrogenase

SCOPe Domain Sequences for d6qaof1:

Sequence, based on SEQRES records: (download)

>d6qaof1 c.82.1.0 (F:1-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnaka
afkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcleyy
aglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvfk
pspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftgsvptgmki
memsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgqvccngtrvfvqkei
ldkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkvakeqgakvlcggdiy
vpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdteaevlerandttfgla
agvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfgrengrvtieyysql
ktvcvemgdvesaf

Sequence, based on observed residues (ATOM records): (download)

>d6qaof1 c.82.1.0 (F:1-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnaka
afkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcleyy
aglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvfk
pspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsfggkspliifs
dcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplledt
rmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrddm
tcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcfi
nnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf

SCOPe Domain Coordinates for d6qaof1:

Click to download the PDB-style file with coordinates for d6qaof1.
(The format of our PDB-style files is described here.)

Timeline for d6qaof1:

  • d6qaof1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11