Lineage for d6octj_ (6oct J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (47 PDB entries)
  8. 3067514Domain d6octj_: 6oct J: [367576]
    automated match to d3drza_

Details for d6octj_

PDB Entry: 6oct (more details), 2.8 Å

PDB Description: crystal structure of human kctd16 t1 domain
PDB Compounds: (J:) btb/poz domain-containing protein kctd16

SCOPe Domain Sequences for d6octj_:

Sequence, based on SEQRES records: (download)

>d6octj_ d.42.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt

Sequence, based on observed residues (ATOM records): (download)

>d6octj_ d.42.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfpevvelnvggqvyftrhstlisiphsllwkmfslakdskgrffidrdgflfryildyl
rdrqvvlpdhfpekgrlkreaeyfqlpdlvkllt

SCOPe Domain Coordinates for d6octj_:

Click to download the PDB-style file with coordinates for d6octj_.
(The format of our PDB-style files is described here.)

Timeline for d6octj_:

  • d6octj_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-11